Class g: Small proteins [56992] (90 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
Protein Bone morphogenetic protein-2 (BMP-2) [57516] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57517] (10 PDB entries) |
Domain d2qj9a_: 2qj9 A: [150823] automated match to d3bmpa_ |
PDB Entry: 2qj9 (more details), 2.44 Å
SCOPe Domain Sequences for d2qj9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qj9a_ g.17.1.2 (A:) Bone morphogenetic protein-2 (BMP-2) {Human (Homo sapiens) [TaxId: 9606]} kssckrhplyvdfsdvgwndwivappgyhafychgecpfpladhlnstnhaivqtlvnsv nskipkaccvptelsaismlyldenekvvlknyqdmvvegcgcr
Timeline for d2qj9a_: