Lineage for d2qj2b2 (2qj2 B:1127-1209)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1461545Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1461546Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 1461547Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 1461564Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)
  7. 1461565Species Human (Homo sapiens) [TaxId:9606] [57458] (6 PDB entries)
  8. 1461567Domain d2qj2b2: 2qj2 B:1127-1209 [150820]
    Other proteins in same PDB: d2qj2a1, d2qj2b1
    automatically matched to d1bhta2
    complexed with so4

Details for d2qj2b2

PDB Entry: 2qj2 (more details), 1.81 Å

PDB Description: A Mechanistic Basis for Converting a Receptor Tyrosine Kinase Agonist to an Antagonist
PDB Compounds: (B:) hepatocyte growth factor

SCOPe Domain Sequences for d2qj2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qj2b2 g.14.1.1 (B:1127-1209) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
nciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeegg
pwcftsnpevryevcdipqcsev

SCOPe Domain Coordinates for d2qj2b2:

Click to download the PDB-style file with coordinates for d2qj2b2.
(The format of our PDB-style files is described here.)

Timeline for d2qj2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qj2b1