![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
![]() | Superfamily g.14.1: Kringle-like [57440] (3 families) ![]() |
![]() | Family g.14.1.1: Kringle modules [57441] (7 proteins) |
![]() | Protein NK1 fragment of hepatocyte growth factor [57457] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57458] (18 PDB entries) |
![]() | Domain d2qj2a2: 2qj2 A:127-209 [150818] Other proteins in same PDB: d2qj2a1, d2qj2b1 automated match to d1bhta2 complexed with so4 |
PDB Entry: 2qj2 (more details), 1.81 Å
SCOPe Domain Sequences for d2qj2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qj2a2 g.14.1.1 (A:127-209) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} nciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeegg pwcftsnpevryevcdipqcsev
Timeline for d2qj2a2: