SCOP 1.75: Domain d2qifb1: 2qif B:1-68

Lineage for d2qifb1 (2qif B:1-68)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (1 family)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (8 proteins)

6. Protein Copper chaperone [55017] (3 species)

7. Species Bacillus subtilis, CopZ [TaxId:1423] [69736] (3 PDB entries)

8. Domain d2qifb1: 2qif B:1-68 [150809]
   automatically matched to d1k0va_
   complexed with act, ca, cu1, gol

Details for d2qifb1

PDB Entry: 2qif, 1.5 Å

PDB Description: crystal structure of a metallochaperone with a tetranuclear cu(i) cluster

PDB Compounds: (B:) Copper chaperone copZ

SCOP Domain Sequences for d2qifb1:

Sequence; same for both SEQRES and ATOM records:

>d2qifb1 d.58.17.1 (B:1-68) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]}
meqktlqvegmscqhcvkavetsvgeldgvsavhvnleagkvdvsfdadkvsvkdiadai
edqgydva

Timeline for d2qifb1:

• d2qifb1 is new in SCOP 1.75
  
• d2qifb1 is called d2qifb_ in SCOPe 2.01
  
• d2qifb1 appears in the current release, SCOPe 2.08, called d2qifb_