SCOPe 2.08: Domain d2qifb_: 2qif B:

Lineage for d2qifb_ (2qif B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein automated matches [190409] (5 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [189117] (3 PDB entries)

8. Domain d2qifb_: 2qif B: [150809]
   automated match to d1k0va_
   complexed with act, ca, cu1, gol

Details for d2qifb_

PDB Entry: 2qif, 1.5 Å

PDB Description: crystal structure of a metallochaperone with a tetranuclear cu(i) cluster

PDB Compounds: (B:) Copper chaperone copZ

SCOPe Domain Sequences for d2qifb_:

Sequence; same for both SEQRES and ATOM records:

>d2qifb_ d.58.17.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
meqktlqvegmscqhcvkavetsvgeldgvsavhvnleagkvdvsfdadkvsvkdiadai
edqgydva

Timeline for d2qifb_:

• d2qifb_ first appeared in SCOP 1.75, called d2qifb1
  
• d2qifb_ appears in SCOPe 2.07