Lineage for d2qifa_ (2qif A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953868Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2953869Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2953988Protein automated matches [190409] (5 species)
    not a true protein
  7. 2953989Species Bacillus subtilis [TaxId:1423] [189117] (3 PDB entries)
  8. 2953990Domain d2qifa_: 2qif A: [150808]
    automated match to d1k0va_
    complexed with act, ca, cu1, gol

Details for d2qifa_

PDB Entry: 2qif (more details), 1.5 Å

PDB Description: crystal structure of a metallochaperone with a tetranuclear cu(i) cluster
PDB Compounds: (A:) Copper chaperone copZ

SCOPe Domain Sequences for d2qifa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qifa_ d.58.17.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
meqktlqvegmscqhcvkavetsvgeldgvsavhvnleagkvdvsfdadkvsvkdiadai
edqgydvak

SCOPe Domain Coordinates for d2qifa_:

Click to download the PDB-style file with coordinates for d2qifa_.
(The format of our PDB-style files is described here.)

Timeline for d2qifa_: