| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
| Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
| Protein automated matches [190409] (5 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [189117] (3 PDB entries) |
| Domain d2qifa_: 2qif A: [150808] automated match to d1k0va_ complexed with act, ca, cu1, gol |
PDB Entry: 2qif (more details), 1.5 Å
SCOPe Domain Sequences for d2qifa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qifa_ d.58.17.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
meqktlqvegmscqhcvkavetsvgeldgvsavhvnleagkvdvsfdadkvsvkdiadai
edqgydvak
Timeline for d2qifa_: