Lineage for d2qidb1 (2qid B:305-481)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 803501Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 803502Protein NS3 protease [50600] (4 species)
  7. 803508Species Dengue virus [TaxId:12637] [159188] (1 PDB entry)
  8. 803510Domain d2qidb1: 2qid B:305-481 [150806]
    Other proteins in same PDB: d2qidc1
    automatically matched to d1befa_

Details for d2qidb1

PDB Entry: 2qid (more details), 2.1 Å

PDB Description: Dengue Virus NS3-Protease Complexed with Mung-Bean Bowman-Birk Inhibitor
PDB Compounds: (B:) Non-structural protein 1 (NS1)

SCOP Domain Sequences for d2qidb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qidb1 b.47.1.3 (B:305-481) NS3 protease {Dengue virus [TaxId: 12637]}
wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr
iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig
avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd

SCOP Domain Coordinates for d2qidb1:

Click to download the PDB-style file with coordinates for d2qidb1.
(The format of our PDB-style files is described here.)

Timeline for d2qidb1:

  • d2qidb1 is new in SCOP 1.75
  • d2qidb1 does not appear in SCOPe 2.01