Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.3: Viral proteases [50596] (4 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein NS3 protease [50600] (4 species) |
Species Dengue virus [TaxId:12637] [159188] (1 PDB entry) |
Domain d2qida1: 2qid A:5-181 [150805] Other proteins in same PDB: d2qidc1 automatically matched to d1befa_ |
PDB Entry: 2qid (more details), 2.1 Å
SCOP Domain Sequences for d2qida1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qida1 b.47.1.3 (A:5-181) NS3 protease {Dengue virus [TaxId: 12637]} wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd
Timeline for d2qida1: