SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2qi9f_ (2qi9 F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143341Family c.92.2.2: TroA-like [53811] (6 protein domains)
  6. 2143359Protein Vitamin B12 binding protein BtuF [82557] (1 species)
  7. 2143360Species Escherichia coli [TaxId:562] [82558] (4 PDB entries)
  8. 2143365Domain d2qi9f_: 2qi9 F: [150803]
    Other proteins in same PDB: d2qi9a_, d2qi9b_, d2qi9c_, d2qi9d_
    automated match to d1n2za_
    complexed with 1pe, peg, po4, so4

Details for d2qi9f_

PDB Entry: 2qi9 (more details), 2.6 Å

PDB Description: ABC-transporter BtuCD in complex with its periplasmic binding protein BtuF
PDB Compounds: (F:) Vitamin B12-binding protein btuF

SCOPe Domain Sequences for d2qi9f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qi9f_ c.92.2.2 (F:) Vitamin B12 binding protein BtuF {Escherichia coli [TaxId: 562]}
aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
lsqvd

SCOPe Domain Coordinates for d2qi9f_:

Click to download the PDB-style file with coordinates for d2qi9f_.
(The format of our PDB-style files is described here.)

Timeline for d2qi9f_: