Lineage for d2qi2a3 (2qi2 A:244-338)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960097Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2960206Family d.79.3.2: ERF1/Dom34 C-terminal domain-like [55323] (3 proteins)
    automatically mapped to Pfam PF03465
  6. 2960210Protein Cell division protein pelota [160506] (2 species)
  7. 2960213Species Thermoplasma acidophilum [TaxId:2303] [160508] (1 PDB entry)
    Uniprot Q9HJ74 244-338
  8. 2960214Domain d2qi2a3: 2qi2 A:244-338 [150802]
    Other proteins in same PDB: d2qi2a1, d2qi2a2

Details for d2qi2a3

PDB Entry: 2qi2 (more details), 2.9 Å

PDB Description: Crystal structure of the Thermoplasma acidophilum Pelota protein
PDB Compounds: (A:) Cell division protein pelota related protein

SCOPe Domain Sequences for d2qi2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qi2a3 d.79.3.2 (A:244-338) Cell division protein pelota {Thermoplasma acidophilum [TaxId: 2303]}
neriardkeivdeflvavkkdmgvygrdqtesalqmgalsdliitdemfrtedgrrslsi
aqtvgtrihivsvsndpgqivkkfggfagilryrv

SCOPe Domain Coordinates for d2qi2a3:

Click to download the PDB-style file with coordinates for d2qi2a3.
(The format of our PDB-style files is described here.)

Timeline for d2qi2a3: