Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (4 families) |
Family d.79.3.2: ERF1/Dom34 C-terminal domain-like [55323] (3 proteins) automatically mapped to Pfam PF03465 |
Protein Cell division protein pelota [160506] (2 species) |
Species Thermoplasma acidophilum [TaxId:2303] [160508] (1 PDB entry) Uniprot Q9HJ74 244-338 |
Domain d2qi2a3: 2qi2 A:244-338 [150802] Other proteins in same PDB: d2qi2a1, d2qi2a2 |
PDB Entry: 2qi2 (more details), 2.9 Å
SCOPe Domain Sequences for d2qi2a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qi2a3 d.79.3.2 (A:244-338) Cell division protein pelota {Thermoplasma acidophilum [TaxId: 2303]} neriardkeivdeflvavkkdmgvygrdqtesalqmgalsdliitdemfrtedgrrslsi aqtvgtrihivsvsndpgqivkkfggfagilryrv
Timeline for d2qi2a3: