| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (3 families) ![]() |
| Family c.55.4.2: ERF1/Dom34 middle domain-like [53143] (3 proteins) automatically mapped to Pfam PF03464 |
| Protein Cell division protein pelota [159647] (1 species) |
| Species Thermoplasma acidophilum [TaxId:2303] [159648] (1 PDB entry) Uniprot Q9HJ74 127-243 |
| Domain d2qi2a2: 2qi2 A:127-243 [150801] Other proteins in same PDB: d2qi2a1, d2qi2a3 |
PDB Entry: 2qi2 (more details), 2.9 Å
SCOPe Domain Sequences for d2qi2a2:
Sequence, based on SEQRES records: (download)
>d2qi2a2 c.55.4.2 (A:127-243) Cell division protein pelota {Thermoplasma acidophilum [TaxId: 2303]}
ekyvtvytavamdedeaqiflihpygiqqvgtvysgrsgkyaegnyseasyfdqivnalk
nysnsiiilgpgfardrfarycaqrgvnvigsfpanrtdsgavyefitsadgaklls
>d2qi2a2 c.55.4.2 (A:127-243) Cell division protein pelota {Thermoplasma acidophilum [TaxId: 2303]}
ekyvtvytavamdedeaqiflihpygiqqvgtvysgrsgkyyseasyfdqivnalknysn
siiilgpgfardrfarycaqrgvnvigsfpanrtdsgavyefitsadgaklls
Timeline for d2qi2a2: