Lineage for d2qhxd_ (2qhx D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2426443Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2426817Protein Dihydropteridin reductase (pteridine reductase) [51769] (7 species)
  7. 2426820Species Leishmania major [TaxId:5664] [63926] (13 PDB entries)
    Uniprot Q01782
  8. 2426829Domain d2qhxd_: 2qhx D: [150799]
    Other proteins in same PDB: d2qhxc_
    automated match to d1p33b_
    complexed with fe1, iod, nap

Details for d2qhxd_

PDB Entry: 2qhx (more details), 2.61 Å

PDB Description: Structure of Pteridine Reductase from Leishmania major complexed with a ligand
PDB Compounds: (D:) pteridine reductase 1

SCOPe Domain Sequences for d2qhxd_:

Sequence, based on SEQRES records: (download)

>d2qhxd_ c.2.1.2 (D:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrnded
ghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamt
nqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrsk
vplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra

Sequence, based on observed residues (ATOM records): (download)

>d2qhxd_ c.2.1.2 (D:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrdreametatad
lfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgale
gltrsaalelaplqirvngvgpglsvlveghrskvplyqrdssaaevsdvviflcsskak
yitgtcvkvdggysltra

SCOPe Domain Coordinates for d2qhxd_:

Click to download the PDB-style file with coordinates for d2qhxd_.
(The format of our PDB-style files is described here.)

Timeline for d2qhxd_: