Lineage for d2qhxc_ (2qhx C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095272Species Leishmania major [TaxId:5664] [226237] (2 PDB entries)
  8. 2095273Domain d2qhxc_: 2qhx C: [150798]
    Other proteins in same PDB: d2qhxa1, d2qhxb1, d2qhxd1
    automated match to d4kwib_
    complexed with fe1, iod, nap

Details for d2qhxc_

PDB Entry: 2qhx (more details), 2.61 Å

PDB Description: Structure of Pteridine Reductase from Leishmania major complexed with a ligand
PDB Compounds: (C:) pteridine reductase 1

SCOPe Domain Sequences for d2qhxc_:

Sequence, based on SEQRES records: (download)

>d2qhxc_ c.2.1.0 (C:) automated matches {Leishmania major [TaxId: 5664]}
vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
lsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndedg
hepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtn
qpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrskv
plyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra

Sequence, based on observed residues (ATOM records): (download)

>d2qhxc_ c.2.1.0 (C:) automated matches {Leishmania major [TaxId: 5664]}
vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrametatadlfgs
naiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgalegltr
saalelaplqirvngvgpglsvlveghrskvplyqrdssaaevsdvviflcsskakyitg
tcvkvdggysltra

SCOPe Domain Coordinates for d2qhxc_:

Click to download the PDB-style file with coordinates for d2qhxc_.
(The format of our PDB-style files is described here.)

Timeline for d2qhxc_: