| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.3: Myb/SANT domain [46739] (15 proteins) |
| Protein Telomere binding protein TBP1 [158244] (1 species) |
| Species Tobacco (Nicotiana tabacum) [TaxId:4097] [158245] (2 PDB entries) Uniprot Q84ZU4 578-660 |
| Domain d2qhbb_: 2qhb B: [150787] automated match to d2ckxa1 protein/DNA complex |
PDB Entry: 2qhb (more details), 2.4 Å
SCOPe Domain Sequences for d2qhbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qhbb_ a.4.1.3 (B:) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
rirrpfsvaevealveavehlgtgrwrdvkmrafdnadhrtyvdlkdkwktlvhtasiap
qqrrgepvpqdlldrvlaahaywsq
Timeline for d2qhbb_: