SCOPe 2.08: Domain d2qh1b1: 2qh1 B:1-142

Lineage for d2qh1b1 (2qh1 B:1-142)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Hypothetical protein Ta0289 [102899] (1 species)
   contains extra C-terminal zinc-finger domain

7. Species Thermoplasma acidophilum [TaxId:2303] [102900] (2 PDB entries)

8. Domain d2qh1b1: 2qh1 B:1-142 [150785]
   Other proteins in same PDB: d2qh1a2, d2qh1b2
   complexed with fe2
   has additional insertions and/or extensions that are not grouped together

Details for d2qh1b1

PDB Entry: 2qh1, 2 Å

PDB Description: structure of ta289, a cbs-rubredoxin-like protein, in its fe+2-bound state

PDB Compounds: (B:) Hypothetical protein Ta0289

SCOPe Domain Sequences for d2qh1b1:

Sequence; same for both SEQRES and ATOM records:

>d2qh1b1 d.37.1.1 (B:1-142) Hypothetical protein Ta0289 {Thermoplasma acidophilum [TaxId: 2303]}
mfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsersiikrfi
prnkkpdevpirlvmrkpipkvksdydvkdvaaylsenglercavvddpgrvvgivtltd
lsrylsrasitdillshrtkdy

Timeline for d2qh1b1:

• d2qh1b1 first appeared in SCOP 1.75
  
• d2qh1b1 appears in SCOPe 2.07