Lineage for d2qh1a1 (2qh1 A:1-142)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550319Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2550320Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2550321Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2550378Protein Hypothetical protein Ta0289 [102899] (1 species)
    contains extra C-terminal zinc-finger domain
  7. 2550379Species Thermoplasma acidophilum [TaxId:2303] [102900] (2 PDB entries)
  8. 2550382Domain d2qh1a1: 2qh1 A:1-142 [150784]
    Other proteins in same PDB: d2qh1a2, d2qh1b2
    complexed with fe2

Details for d2qh1a1

PDB Entry: 2qh1 (more details), 2 Å

PDB Description: structure of ta289, a cbs-rubredoxin-like protein, in its fe+2-bound state
PDB Compounds: (A:) Hypothetical protein Ta0289

SCOPe Domain Sequences for d2qh1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qh1a1 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Thermoplasma acidophilum [TaxId: 2303]}
mfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsersiikrfi
prnkkpdevpirlvmrkpipkvksdydvkdvaaylsenglercavvddpgrvvgivtltd
lsrylsrasitdillshrtkdy

SCOPe Domain Coordinates for d2qh1a1:

Click to download the PDB-style file with coordinates for d2qh1a1.
(The format of our PDB-style files is described here.)

Timeline for d2qh1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qh1a2