Lineage for d2qgsb_ (2qgs B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014837Family a.211.1.1: HD domain [101340] (14 protein domains)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2014909Protein Uncharacterized protein SE1688 [158723] (1 species)
  7. 2014910Species Staphylococcus epidermidis [TaxId:1282] [158724] (1 PDB entry)
    Uniprot Q8CRP0 1-216
  8. 2014912Domain d2qgsb_: 2qgs B: [150783]
    automated match to d2qgsa1
    complexed with zn

Details for d2qgsb_

PDB Entry: 2qgs (more details), 2 Å

PDB Description: crystal structure of se1688 protein from staphylococcus epidermidis. northeast structural genomics consortium target ser89
PDB Compounds: (B:) Protein SE1688

SCOPe Domain Sequences for d2qgsb_:

Sequence, based on SEQRES records: (download)

>d2qgsb_ a.211.1.1 (B:) Uncharacterized protein SE1688 {Staphylococcus epidermidis [TaxId: 1282]}
mnsrmkikkayeymksfhqhdttghdiahvervynnacyiakrenitdtlvielssllhd
tvdskltdeilaydqlkqflstldlsseisqqvlyiikhmsyragknnhvklsidgeivr
dadrldaigaigiartfqfsghfgepmwtetklsneelhtslveeldnsaikhfyeklfk
lkdlmhtptakklaeerhqfmiqylkqfmsewnfnke

Sequence, based on observed residues (ATOM records): (download)

>d2qgsb_ a.211.1.1 (B:) Uncharacterized protein SE1688 {Staphylococcus epidermidis [TaxId: 1282]}
mnsrmkikkayeymksfhqhdttghdiahvervynnacyiakrenitdtlvielssllhd
tvydqlkqflstldlsseisqqvlyiikhmhvklsidgeivrdadrldaigaigiartfq
fsghfgepmwtetklsneelhtslveeldnsaikhfyeklfklkdlmhtptakklaeerh
qfmiqylkqfmsewnfnke

SCOPe Domain Coordinates for d2qgsb_:

Click to download the PDB-style file with coordinates for d2qgsb_.
(The format of our PDB-style files is described here.)

Timeline for d2qgsb_: