Lineage for d2qgma1 (2qgm A:33-445)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2152132Fold c.150: EreA/ChaN-like [159500] (1 superfamily)
    Core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order:51423;
  4. 2152133Superfamily c.150.1: EreA/ChaN-like [159501] (3 families) (S)
    there are four conserved residues in the putative active site: two His and two Glu
  5. 2152145Family c.150.1.3: EreA-like [159508] (2 protein domains)
    Pfam PF05139; Erythromycin esterase-like; the superfamily core is decorated with insertion of a four-helical bundle and a C-terminal alpha+beta extension
  6. 2152151Protein Succinoglycan biosynthesis protein BC3205 [159511] (1 species)
  7. 2152152Species Bacillus cereus [TaxId:1396] [159512] (1 PDB entry)
    Uniprot Q81BF7 33-445
  8. 2152153Domain d2qgma1: 2qgm A:33-445 [150781]

Details for d2qgma1

PDB Entry: 2qgm (more details), 1.7 Å

PDB Description: Crystal structure of succinoglycan biosynthesis protein at the resolution 1.7 A. Northeast Structural Genomics Consortium target BcR136.
PDB Compounds: (A:) Succinoglycan biosynthesis protein

SCOPe Domain Sequences for d2qgma1:

Sequence, based on SEQRES records: (download)

>d2qgma1 c.150.1.3 (A:33-445) Succinoglycan biosynthesis protein BC3205 {Bacillus cereus [TaxId: 1396]}
sgqsvqknivksiqsqanplktiepskpfedlkplkkmignaqyvglgenthgsseiftm
kfrlvkylvtemgftnfameedwgnglklneyiqtgkgnpreflkllyptdeiiamiewm
kdynadpsnkkkiqfigldlkaldqgsfnkvidyvrlhrpdllaeveenykelssftgsi
qeymkltpklkekfkanaervarllkdeneqanteiipseyiwakatasaiekfttmllp
ndypsiiklheqyladhamwaqetfggktmvwahnihiakgiideklypyvagqflkerl
dnnyvtigstttegnftlyseynpstggkittdtipqdvksfnytlgkvpykmflldnrh
lkgqaekwvkakrpllsiggqilpnssvyfdtslleqfdiifhirktspshik

Sequence, based on observed residues (ATOM records): (download)

>d2qgma1 c.150.1.3 (A:33-445) Succinoglycan biosynthesis protein BC3205 {Bacillus cereus [TaxId: 1396]}
sgqsvqknivksiqsqanplktiepskpfedlkplkkmignaqyvglgenthgsseiftm
kfrlvkylvtemgftnfameedwgnglklneyiqtgkgnpreflkllyptdeiiamiewm
kdynadpsnkkkiqfigldlkaldqgsfnkvidyvrlhrpdllaeveenykelssftgsi
qeymkltpklkekfkanaervarllkdeeyiwakatasaiekfttmllpndypsiiklhe
qyladhamwaqetfggktmvwahnihiakgiideklypyvagqflkerldnnyvtigstt
tegnftlyseygkittdtipqdvksfnytlgkvpykmflldnrhlkgqaekwvkakrpll
siggqivyfdtslleqfdiifhirktspshik

SCOPe Domain Coordinates for d2qgma1:

Click to download the PDB-style file with coordinates for d2qgma1.
(The format of our PDB-style files is described here.)

Timeline for d2qgma1: