SCOPe 2.03: Domain d2qgfa1: 2qgf A:1-150

Lineage for d2qgfa1 (2qgf A:1-150)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (6 species)

7. Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
   Uniprot P00479

8. Domain d2qgfa1: 2qgf A:1-150 [150773]
   Other proteins in same PDB: d2qgfb1, d2qgfb2, d2qgfd1, d2qgfd2
   automated match to d3csua1
   complexed with zn; mutant

Details for d2qgfa1

PDB Entry: 2qgf, 2.2 Å

PDB Description: structure of regulatory chain mutant h20a of asparate transcarbamoylase from e. coli

PDB Compounds: (A:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d2qgfa1:

Sequence; same for both SEQRES and ATOM records:

>d2qgfa1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d2qgfa1:

• d2qgfa1 first appeared in SCOP 1.75
  
• d2qgfa1 appears in SCOPe 2.02
  
• d2qgfa1 appears in SCOPe 2.04
  
• d2qgfa1 appears in the current release, SCOPe 2.08