Lineage for d2qgda1 (2qgd A:11-125)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790527Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family) (S)
  5. 790528Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)
  6. 790529Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
    sandwich; 8 strands in 2 sheets
  7. 790550Species Human (Homo sapiens) [TaxId:9606] [49475] (79 PDB entries)
    Uniprot P02766 31-143
  8. 790563Domain d2qgda1: 2qgd A:11-125 [150769]
    automatically matched to d1bzda_
    complexed with mr5

Details for d2qgda1

PDB Entry: 2qgd (more details), 1.5 Å

PDB Description: human transthyretin (ttr) complexed with 2-(3,5-dibromo-4- hydroxyphenyl)benzoxazole
PDB Compounds: (A:) Transthyretin

SCOP Domain Sequences for d2qgda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qgda1 b.3.4.1 (A:11-125) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

SCOP Domain Coordinates for d2qgda1:

Click to download the PDB-style file with coordinates for d2qgda1.
(The format of our PDB-style files is described here.)

Timeline for d2qgda1: