SCOP 1.75: Domain d2qgbb1: 2qgb B:11-124

Lineage for d2qgbb1 (2qgb B:11-124)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (79 PDB entries)
   Uniprot P02766 31-143

8. Domain d2qgbb1: 2qgb B:11-124 [150766]
   automatically matched to d1bzda_

Details for d2qgbb1

PDB Entry: 2qgb, 1.4 Å

PDB Description: human transthyretin (ttr) in apo-form

PDB Compounds: (B:) Transthyretin

SCOP Domain Sequences for d2qgbb1:

Sequence; same for both SEQRES and ATOM records:

>d2qgbb1 b.3.4.1 (B:11-124) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Timeline for d2qgbb1:

• d2qgbb1 is new in SCOP 1.75
  
• d2qgbb1 is called d2qgbb_ in SCOPe 2.01
  
• d2qgbb1 appears in the current release, SCOPe 2.08, called d2qgbb_