SCOPe 2.03: Domain d2qfra2: 2qfr A:121-432

Lineage for d2qfra2 (2qfr A:121-432)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)

6. Protein Plant purple acid phosphatase, catalytic domain [56302] (2 species)
   also contain an Ig-like domain

7. Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [56303] (5 PDB entries)

8. Domain d2qfra2: 2qfr A:121-432 [150751]
   Other proteins in same PDB: d2qfra1, d2qfrb1
   automatically matched to d1kbpa2
   complexed with fe, nag, ndg, so4, zn

Details for d2qfra2

PDB Entry: 2qfr, 2.4 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase with bound sulfate

PDB Compounds: (A:) purple acid phosphatase

SCOPe Domain Sequences for d2qfra2:

Sequence; same for both SEQRES and ATOM records:

>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvddst

Timeline for d2qfra2:

• d2qfra2 first appeared in SCOP 1.75
  
• d2qfra2 appears in SCOPe 2.02
  
• d2qfra2 appears in SCOPe 2.04
  
• d2qfra2 appears in the current release, SCOPe 2.08