![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) ![]() |
![]() | Family b.1.12.0: automated matches [227279] (1 protein) not a true family |
![]() | Protein automated matches [227090] (1 species) not a true protein |
![]() | Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (6 PDB entries) |
![]() | Domain d2qfpb1: 2qfp B:9-120 [150744] Other proteins in same PDB: d2qfpa2, d2qfpb2, d2qfpc2, d2qfpd2 automated match to d2qfra1 complexed with f, fe, na, nag, ndg, so4, zn |
PDB Entry: 2qfp (more details), 2.2 Å
SCOPe Domain Sequences for d2qfpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qfpb1 b.1.12.0 (B:9-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]} rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
Timeline for d2qfpb1: