SCOPe 2.05: Domain d2qfpb1: 2qfp B:9-120

Lineage for d2qfpb1 (2qfp B:9-120)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families)

5. Family b.1.12.0: automated matches [227279] (1 protein)
   not a true family

6. Protein automated matches [227090] (1 species)
   not a true protein

7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (6 PDB entries)

8. Domain d2qfpb1: 2qfp B:9-120 [150744]
   Other proteins in same PDB: d2qfpa2, d2qfpb2, d2qfpc2, d2qfpd2
   automated match to d2qfra1
   complexed with f, fe, na, nag, ndg, so4, zn

Details for d2qfpb1

PDB Entry: 2qfp, 2.2 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase in complex with fluoride

PDB Compounds: (B:) purple acid phosphatase

SCOPe Domain Sequences for d2qfpb1:

Sequence; same for both SEQRES and ATOM records:

>d2qfpb1 b.1.12.0 (B:9-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

Timeline for d2qfpb1:

• d2qfpb1 first appeared in SCOP 1.75
  
• d2qfpb1 appears in SCOPe 2.04
  
• d2qfpb1 appears in SCOPe 2.06
  
• d2qfpb1 appears in the current release, SCOPe 2.08