SCOP 1.75: Domain d2qfkb1: 2qfk B:1-137

Lineage for d2qfkb1 (2qfk B:1-137)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (3 PDB entries)

8. Domain d2qfkb1: 2qfk B:1-137 [150739]
   automatically matched to d1ew6a_
   complexed with hem, nh4, so4

Details for d2qfkb1

PDB Entry: 2qfk, 1.62 Å

PDB Description: x-ray crystal structure analysis of the binding site in the ferric and oxyferrous forms of the recombinant heme dehaloperoxidase cloned from amphitrite ornata

PDB Compounds: (B:) Dehaloperoxidase A

SCOP Domain Sequences for d2qfkb1:

Sequence; same for both SEQRES and ATOM records:

>d2qfkb1 a.1.1.2 (B:1-137) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d2qfkb1:

• d2qfkb1 is new in SCOP 1.75
  
• d2qfkb1 is called d2qfkb_ in SCOPe 2.01
  
• d2qfkb1 appears in the current release, SCOPe 2.08, called d2qfkb_