SCOPe 2.05: Domain d2qfka_: 2qfk A:

Lineage for d2qfka_ (2qfk A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (31 PDB entries)

8. Domain d2qfka_: 2qfk A: [150738]
   automated match to d1ew6a_
   complexed with hem, nh4, so4

Details for d2qfka_

PDB Entry: 2qfk, 1.62 Å

PDB Description: x-ray crystal structure analysis of the binding site in the ferric and oxyferrous forms of the recombinant heme dehaloperoxidase cloned from amphitrite ornata

PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d2qfka_:

Sequence; same for both SEQRES and ATOM records:

>d2qfka_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d2qfka_:

• d2qfka_ first appeared in SCOP 1.75, called d2qfka1
  
• d2qfka_ appears in SCOPe 2.04
  
• d2qfka_ appears in SCOPe 2.06
  
• d2qfka_ appears in the current release, SCOPe 2.08