SCOPe 2.03: Domain d2qf8a2: 2qf8 A:241-308

Lineage for d2qf8a2 (2qf8 A:241-308)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
   secreted during involution

7. Species Buffalo (Bubalus bubalis) [TaxId:89462] [110873] (6 PDB entries)
   Uniprot Q7YS85

8. Domain d2qf8a2: 2qf8 A:241-308 [150732]
   Other proteins in same PDB: d2qf8a1
   automated match to d1tfva2
   complexed with nag

Details for d2qf8a2

PDB Entry: 2qf8, 2.8 Å

PDB Description: crystal structure of the complex of buffalo secretory glycoprotein with tetrasaccharide at 2.8a resolution

PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d2qf8a2:

Sequence; same for both SEQRES and ATOM records:

>d2qf8a2 d.26.3.1 (A:241-308) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis) [TaxId: 89462]}
grsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyatk
gnqwvayd

Timeline for d2qf8a2:

• d2qf8a2 first appeared in SCOP 1.75
  
• d2qf8a2 appears in SCOPe 2.02
  
• d2qf8a2 appears in SCOPe 2.04
  
• d2qf8a2 appears in the current release, SCOPe 2.08