Lineage for d2qf6d_ (2qf6 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2579778Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2579779Protein HSP90 [55876] (3 species)
  7. 2579883Species Human (Homo sapiens) [TaxId:9606] [55878] (146 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 2580056Domain d2qf6d_: 2qf6 D: [150730]
    automated match to d1yc3a_
    complexed with a56

Details for d2qf6d_

PDB Entry: 2qf6 (more details), 3.1 Å

PDB Description: HSP90 complexed with A56322
PDB Compounds: (D:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d2qf6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qf6d_ d.122.1.1 (D:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfve

SCOPe Domain Coordinates for d2qf6d_:

Click to download the PDB-style file with coordinates for d2qf6d_.
(The format of our PDB-style files is described here.)

Timeline for d2qf6d_: