![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
![]() | Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
![]() | Protein HSP90 [55876] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55878] (189 PDB entries) Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223 |
![]() | Domain d2qf6d_: 2qf6 D: [150730] automated match to d1yc3a_ complexed with a56 |
PDB Entry: 2qf6 (more details), 3.1 Å
SCOPe Domain Sequences for d2qf6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qf6d_ d.122.1.1 (D:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpskldsgkel hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte yleerrikeivkkhsqfigypitlfve
Timeline for d2qf6d_: