Lineage for d2qf3c_ (2qf3 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793085Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 1793224Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)
  7. 1793225Species Escherichia coli [TaxId:562] [110237] (12 PDB entries)
    Uniprot P31137 37-354 ! Uniprot P31137
  8. 1793228Domain d2qf3c_: 2qf3 C: [150726]
    automated match to d3lgib_
    complexed with po4

Details for d2qf3c_

PDB Entry: 2qf3 (more details), 2.04 Å

PDB Description: structure of the delta pdz truncation of the degs protease
PDB Compounds: (C:) Protease degS

SCOPe Domain Sequences for d2qf3c_:

Sequence, based on SEQRES records: (download)

>d2qf3c_ b.47.1.1 (C:) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
etpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
ksndgetpegigfaipfqlatkimdklird

Sequence, based on observed residues (ATOM records): (download)

>d2qf3c_ b.47.1.1 (C:) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
etpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
ynlgqtitqgiisatgrqnflqtdasinhgnsggalvnslgelmgintlsftpegigfai
pfqlatkimdklird

SCOPe Domain Coordinates for d2qf3c_:

Click to download the PDB-style file with coordinates for d2qf3c_.
(The format of our PDB-style files is described here.)

Timeline for d2qf3c_: