Lineage for d2qf0i1 (2qf0 I:43-252)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802047Family b.47.1.1: Prokaryotic proteases [50495] (15 proteins)
  6. 802187Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)
  7. 802188Species Escherichia coli [TaxId:562] [110237] (9 PDB entries)
    Uniprot P31137 37-354
    Uniprot P31137
    Uniprot P31137 37-354 ! Uniprot P31137
  8. 802212Domain d2qf0i1: 2qf0 I:43-252 [150723]
    automatically matched to d1sota2

Details for d2qf0i1

PDB Entry: 2qf0 (more details), 2.5 Å

PDB Description: structure of the delta pdz truncation of the degs protease
PDB Compounds: (I:) Protease degS

SCOP Domain Sequences for d2qf0i1:

Sequence, based on SEQRES records: (download)

>d2qf0i1 b.47.1.1 (I:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
tpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvindad
qiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpy
nlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdk
sndgetpegigfaipfqlatkimdklirdg

Sequence, based on observed residues (ATOM records): (download)

>d2qf0i1 b.47.1.1 (I:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
tpasynlavrraapavvnvynrgirtlgsgvimdqrgyiitnkhvindadqiivalqdgr
vfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpynlgqtitqgi
isatgflqtdasinhgnsggalvnslgelmgintlsfdgetpegigfaipfqlatkimdk
lirdg

SCOP Domain Coordinates for d2qf0i1:

Click to download the PDB-style file with coordinates for d2qf0i1.
(The format of our PDB-style files is described here.)

Timeline for d2qf0i1: