SCOPe 2.06: Domain d2qf0c_: 2qf0 C:

Lineage for d2qf0c_ (2qf0 C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)

7. Species Escherichia coli [TaxId:562] [110237] (12 PDB entries)
   Uniprot P31137 37-354 ! Uniprot P31137

8. Domain d2qf0c_: 2qf0 C: [150717]
   automated match to d3lgib_

Details for d2qf0c_

PDB Entry: 2qf0, 2.5 Å

PDB Description: structure of the delta pdz truncation of the degs protease

PDB Compounds: (C:) Protease degS

SCOPe Domain Sequences for d2qf0c_:

Sequence, based on SEQRES records:

>d2qf0c_ b.47.1.1 (C:) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
detpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvind
adqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaign
pynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsf
dksndgetpegigfaipfqlatkimdklirdg

Sequence, based on observed residues (ATOM records):

>d2qf0c_ b.47.1.1 (C:) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
detpasynlavrraapavvnvynrglntqleirtlgsgvimdqrgyiitnkhvindadqi
ivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpynl
gqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdksg
etpegigfaipfqlatkimdklirdg

Timeline for d2qf0c_:

• d2qf0c_ first appeared in SCOP 1.75, called d2qf0c1
  
• d2qf0c_ appears in SCOPe 2.05
  
• d2qf0c_ appears in SCOPe 2.07
  
• d2qf0c_ appears in the current release, SCOPe 2.08