Lineage for d2qexz1 (2qex Z:10-82)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066475Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1066476Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 1066477Protein Ribosomal protein L37ae [57831] (1 species)
  7. 1066478Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 1066517Domain d2qexz1: 2qex Z:10-82 [150714]
    Other proteins in same PDB: d2qex11, d2qex21, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1
    automatically matched to d1s72z_
    complexed with cd, cl, k, mg, na, neg

Details for d2qexz1

PDB Entry: 2qex (more details), 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d2qexz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qexz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
rsgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsy
kpetpggktvrrs

SCOPe Domain Coordinates for d2qexz1:

Click to download the PDB-style file with coordinates for d2qexz1.
(The format of our PDB-style files is described here.)

Timeline for d2qexz1: