Lineage for d2qexx1 (2qex X:7-88)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2269333Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2269468Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2269615Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2269658Domain d2qexx1: 2qex X:7-88 [150712]
    Other proteins in same PDB: d2qex21, d2qexb1, d2qexc1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexk1, d2qexm1, d2qexp1, d2qexr1, d2qexs1, d2qexy1, d2qexz1
    automatically matched to d1w2bw_
    complexed with cd, cl, k, mg, na, neg

Details for d2qexx1

PDB Entry: 2qex (more details), 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOPe Domain Sequences for d2qexx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qexx1 i.1.1.2 (X:7-88) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOPe Domain Coordinates for d2qexx1:

Click to download the PDB-style file with coordinates for d2qexx1.
(The format of our PDB-style files is described here.)

Timeline for d2qexx1: