Lineage for d2myd__ (2myd -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531553Protein Myoglobin [46469] (9 species)
  7. 531626Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (151 PDB entries)
  8. 531703Domain d2myd__: 2myd - [15071]
    complexed with hem, npn, so4

Details for d2myd__

PDB Entry: 2myd (more details), 1.8 Å

PDB Description: high resolution x-ray structures of myoglobin-and hemoglobin-alkyl isocyanide complexes

SCOP Domain Sequences for d2myd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2myd__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d2myd__:

Click to download the PDB-style file with coordinates for d2myd__.
(The format of our PDB-style files is described here.)

Timeline for d2myd__: