Lineage for d2qext1 (2qex T:1-119)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1971716Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 1971851Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 1971998Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1972205Domain d2qext1: 2qex T:1-119 [150708]
    Other proteins in same PDB: d2qex21, d2qexb1, d2qexc1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexk1, d2qexm1, d2qexp1, d2qexr1, d2qexs1, d2qexy1, d2qexz1
    automatically matched to d1w2bs_
    complexed with cd, cl, k, mg, na, neg

Details for d2qext1

PDB Entry: 2qex (more details), 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
PDB Compounds: (T:) 50S ribosomal protein L24P

SCOPe Domain Sequences for d2qext1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qext1 i.1.1.2 (T:1-119) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOPe Domain Coordinates for d2qext1:

Click to download the PDB-style file with coordinates for d2qext1.
(The format of our PDB-style files is described here.)

Timeline for d2qext1: