![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.2: Large subunit [58124] (1 protein) |
![]() | Protein 50S subunit [58125] (6 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
![]() | Domain d2qexq1: 2qex Q:1-95 [150705] Other proteins in same PDB: d2qex21, d2qexb1, d2qexc1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexk1, d2qexm1, d2qexp1, d2qexr1, d2qexs1, d2qexy1, d2qexz1 automatically matched to d1w2bp_ complexed with cd, cl, k, mg, na, neg |
PDB Entry: 2qex (more details), 2.9 Å
SCOPe Domain Sequences for d2qexq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qexq1 i.1.1.2 (Q:1-95) 50S subunit {Haloarcula marismortui [TaxId: 2238]} pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt gtvegkqgdaykvdivdggkektiivtaahlrrqe
Timeline for d2qexq1:
![]() Domains from other chains: (mouse over for more information) d2qex11, d2qex21, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1 |