Lineage for d2qexm1 (2qex M:1-194)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891281Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 1891282Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 1891394Family d.12.1.2: L15e [54193] (1 protein)
    elaborated with additional structures
    automatically mapped to Pfam PF00827
  6. 1891395Protein Ribosomal protein L15e [54194] (1 species)
  7. 1891396Species Haloarcula marismortui [TaxId:2238] [54195] (42 PDB entries)
    Uniprot P60618
  8. 1891420Domain d2qexm1: 2qex M:1-194 [150701]
    Other proteins in same PDB: d2qex11, d2qex21, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1
    automatically matched to d1s72m_
    complexed with cd, cl, k, mg, na, neg

Details for d2qexm1

PDB Entry: 2qex (more details), 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
PDB Compounds: (M:) 50S ribosomal protein L15e

SCOPe Domain Sequences for d2qexm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qexm1 d.12.1.2 (M:1-194) Ribosomal protein L15e {Haloarcula marismortui [TaxId: 2238]}
arsaysyirdawenpgdgqlaelqwqrqqewrnegaverierptrldkarsqgykakqgv
ivarvsvrkgsarkrrhkagrrskrqgvtritrrkdiqrvaeerasrtfpnlrvlnsysv
gqdgrqkwhevilidpnhpaiqndddlswicaddqadrvfrgltgagrrnrglsgkgkgs
ektrpslrsnggka

SCOPe Domain Coordinates for d2qexm1:

Click to download the PDB-style file with coordinates for d2qexm1.
(The format of our PDB-style files is described here.)

Timeline for d2qexm1: