Lineage for d2qexi1 (2qex I:71-134)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 907458Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 907459Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 907460Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 907508Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
    Uniprot P14122 67-136
  8. 907543Domain d2qexi1: 2qex I:71-134 [150697]
    Other proteins in same PDB: d2qex11, d2qex21, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexf1, d2qexg1, d2qexh1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1
    automatically matched to d1s72i_
    complexed with cd, cl, k, mg, na, neg

Details for d2qexi1

PDB Entry: 2qex (more details), 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d2qexi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qexi1 a.4.7.1 (I:71-134) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tcts

SCOPe Domain Coordinates for d2qexi1:

Click to download the PDB-style file with coordinates for d2qexi1.
(The format of our PDB-style files is described here.)

Timeline for d2qexi1: