Lineage for d2qexg1 (2qex G:12-73)

  1. Root: SCOPe 2.01
  2. 1072259Class j: Peptides [58231] (120 folds)
  3. 1073736Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 1073737Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 1073738Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 1073739Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 1073740Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 1073764Domain d2qexg1: 2qex G:12-73 [150695]
    Other proteins in same PDB: d2qex11, d2qex21, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexf1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1
    automatically matched to 1VQ4 G:12-73
    complexed with cd, cl, k, mg, na, neg

Details for d2qexg1

PDB Entry: 2qex (more details), 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
PDB Compounds: (G:) Acidic ribosomal protein P0 homolog

SCOPe Domain Sequences for d2qexg1:

Sequence, based on SEQRES records: (download)

>d2qexg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d2qexg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d2qexg1:

Click to download the PDB-style file with coordinates for d2qexg1.
(The format of our PDB-style files is described here.)

Timeline for d2qexg1: