Lineage for d2qexf1 (2qex F:1-119)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914576Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 1914577Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 1914594Protein Ribosomal protein L7ae [55319] (7 species)
  7. 1914602Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 1914640Domain d2qexf1: 2qex F:1-119 [150694]
    Other proteins in same PDB: d2qex11, d2qex21, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1
    automatically matched to d1s72f_
    complexed with cd, cl, k, mg, na, neg

Details for d2qexf1

PDB Entry: 2qex (more details), 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d2qexf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qexf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

SCOPe Domain Coordinates for d2qexf1:

Click to download the PDB-style file with coordinates for d2qexf1.
(The format of our PDB-style files is described here.)

Timeline for d2qexf1: