Lineage for d2qex21 (2qex 2:1-49)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925761Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 925762Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 925763Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 925764Protein Ribosomal protein L39e [48664] (1 species)
  7. 925765Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 925804Domain d2qex21: 2qex 2:1-49 [150689]
    Other proteins in same PDB: d2qex11, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1
    automatically matched to 1VQ4 2:1-49
    complexed with cd, cl, k, mg, na, neg

Details for d2qex21

PDB Entry: 2qex (more details), 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d2qex21:

Sequence, based on SEQRES records: (download)

>d2qex21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d2qex21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

SCOPe Domain Coordinates for d2qex21:

Click to download the PDB-style file with coordinates for d2qex21.
(The format of our PDB-style files is described here.)

Timeline for d2qex21: