SCOPe 2.02: Domain d2qeld_: 2qel D:

Lineage for d2qeld_ (2qel D:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (150 PDB entries)
   Uniprot P02766 31-143

8. Domain d2qeld_: 2qel D: [150687]
   automated match to d1eta1_
   mutant

Details for d2qeld_

PDB Entry: 2qel, 2.29 Å

PDB Description: crystal structure of the highly amyloidogenic transthyretin mutant ttr g53s/e54d/l55s- heated protein

PDB Compounds: (D:) Transthyretin

SCOPe Domain Sequences for d2qeld_:

Sequence; same for both SEQRES and ATOM records:

>d2qeld_ b.3.4.1 (D:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

Timeline for d2qeld_:

• d2qeld_ first appeared in SCOP 1.75, called d2qeld1
  
• d2qeld_ appears in SCOPe 2.01
  
• d2qeld_ appears in SCOPe 2.03
  
• d2qeld_ appears in the current release, SCOPe 2.08