Lineage for d2qelc1 (2qel C:12-125)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790527Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family) (S)
  5. 790528Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)
  6. 790529Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
    sandwich; 8 strands in 2 sheets
  7. 790550Species Human (Homo sapiens) [TaxId:9606] [49475] (79 PDB entries)
    Uniprot P02766 31-143
  8. 790711Domain d2qelc1: 2qel C:12-125 [150686]
    automatically matched to d1g1od_
    mutant

Details for d2qelc1

PDB Entry: 2qel (more details), 2.29 Å

PDB Description: crystal structure of the highly amyloidogenic transthyretin mutant ttr g53s/e54d/l55s- heated protein
PDB Compounds: (C:) Transthyretin

SCOP Domain Sequences for d2qelc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qelc1 b.3.4.1 (C:12-125) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
lmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltteeefvegiykv
eidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

SCOP Domain Coordinates for d2qelc1:

Click to download the PDB-style file with coordinates for d2qelc1.
(The format of our PDB-style files is described here.)

Timeline for d2qelc1: