SCOP 1.75: Domain d2qejb2: 2qej B:343-450

Lineage for d2qejb2 (2qej B:343-450)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha [89183] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89184] (2 PDB entries)

8. Domain d2qejb2: 2qej B:343-450 [150683]
   Other proteins in same PDB: d2qeja1, d2qejb1
   automatically matched to d1ow0a2
   complexed with ca, gol, nag

Details for d2qejb2

PDB Entry: 2qej, 3.2 Å

PDB Description: crystal structure of a staphylococcus aureus protein (ssl7) in complex with fc of human iga1

PDB Compounds: (B:) ig alpha-1 c region

SCOP Domain Sequences for d2qejb2:

Sequence; same for both SEQRES and ATOM records:

>d2qejb2 b.1.1.2 (B:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]}
ntfrpevhllpppseelalnelvtltclargfspkdvlvrwlqgsqelprekyltwasrq
epsqgtttfavtsilrvaaedwkkgdtfscmvghealplaftqktidr

Timeline for d2qejb2:

• d2qejb2 is new in SCOP 1.75
  
• d2qejb2 appears in SCOPe 2.01
  
• d2qejb2 appears in the current release, SCOPe 2.08