Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha [89181] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89182] (2 PDB entries) |
Domain d2qeja1: 2qej A:242-342 [150680] Other proteins in same PDB: d2qeja2, d2qeja3, d2qejb2 automatically matched to d1ow0a1 complexed with ca, gol |
PDB Entry: 2qej (more details), 3.2 Å
SCOPe Domain Sequences for d2qeja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qeja1 b.1.1.2 (A:242-342) Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha {Human (Homo sapiens) [TaxId: 9606]} chprlslhrpaledlllgseanltctltglrdasgvtftwtpssgksavqgpperdlcgc ysvssvlpgcaepwnhgktftctaaypesktpltatlsksg
Timeline for d2qeja1: