Lineage for d1ajh__ (1ajh -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436886Protein Myoglobin [46469] (9 species)
  7. 436959Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (151 PDB entries)
  8. 437019Domain d1ajh__: 1ajh - [15068]

Details for d1ajh__

PDB Entry: 1ajh (more details), 1.7 Å

PDB Description: photoproduct of carbonmonoxy myoglobin at 40 k

SCOP Domain Sequences for d1ajh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ajh__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d1ajh__:

Click to download the PDB-style file with coordinates for d1ajh__.
(The format of our PDB-style files is described here.)

Timeline for d1ajh__: