SCOPe 2.05: Domain d2qeda1: 2qed A:1-251

Lineage for d2qeda1 (2qed A:1-251)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.2: Glyoxalase II (hydroxyacylglutathione hydrolase) [56288] (1 protein)

6. Protein Glyoxalase II (hydroxyacylglutathione hydrolase) [56289] (3 species)

7. Species Salmonella typhimurium [TaxId:90371] [160851] (1 PDB entry)
   Uniprot Q8ZRM2 1-251

8. Domain d2qeda1: 2qed A:1-251 [150676]
   complexed with edo, fe

Details for d2qeda1

PDB Entry: 2qed, 1.45 Å

PDB Description: Crystal structure of Salmonella thyphimurium LT2 glyoxalase II

PDB Compounds: (A:) Hydroxyacylglutathione hydrolase

SCOPe Domain Sequences for d2qeda1:

Sequence; same for both SEQRES and ATOM records:

>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]}
mnlnsipafqdnyiwvltndegrcvivdpgeaapvlkaiaehkwmpeaiflthhhhdhvg
gvkellqhfpqmtvygpaetqdkgathlvgdgdtirvlgekftlfatpghtlghvcyfsr
pylfcgdtlfsggcgrlfegtpsqmyqslmkinslpddtliccaheytlanikfalsilp
hdsfineyyrkvkelrvkkqmtlpvilknerkinlflrtedidlineinketilqqpear
fawlrskkdtf

Timeline for d2qeda1:

• d2qeda1 first appeared in SCOP 1.75
  
• d2qeda1 appears in SCOPe 2.04
  
• d2qeda1 appears in SCOPe 2.06
  
• d2qeda1 appears in the current release, SCOPe 2.08