Lineage for d2qeda1 (2qed A:1-251)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679369Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1679370Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1679576Family d.157.1.2: Glyoxalase II (hydroxyacylglutathione hydrolase) [56288] (1 protein)
  6. 1679577Protein Glyoxalase II (hydroxyacylglutathione hydrolase) [56289] (3 species)
  7. 1679583Species Salmonella typhimurium [TaxId:90371] [160851] (1 PDB entry)
    Uniprot Q8ZRM2 1-251
  8. 1679584Domain d2qeda1: 2qed A:1-251 [150676]
    complexed with edo, fe

Details for d2qeda1

PDB Entry: 2qed (more details), 1.45 Å

PDB Description: Crystal structure of Salmonella thyphimurium LT2 glyoxalase II
PDB Compounds: (A:) Hydroxyacylglutathione hydrolase

SCOPe Domain Sequences for d2qeda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]}
mnlnsipafqdnyiwvltndegrcvivdpgeaapvlkaiaehkwmpeaiflthhhhdhvg
gvkellqhfpqmtvygpaetqdkgathlvgdgdtirvlgekftlfatpghtlghvcyfsr
pylfcgdtlfsggcgrlfegtpsqmyqslmkinslpddtliccaheytlanikfalsilp
hdsfineyyrkvkelrvkkqmtlpvilknerkinlflrtedidlineinketilqqpear
fawlrskkdtf

SCOPe Domain Coordinates for d2qeda1:

Click to download the PDB-style file with coordinates for d2qeda1.
(The format of our PDB-style files is described here.)

Timeline for d2qeda1: