Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (14 families) |
Family d.157.1.2: Glyoxalase II (hydroxyacylglutathione hydrolase) [56288] (1 protein) |
Protein Glyoxalase II (hydroxyacylglutathione hydrolase) [56289] (3 species) |
Species Salmonella typhimurium [TaxId:90371] [160851] (1 PDB entry) Uniprot Q8ZRM2 1-251 |
Domain d2qeda1: 2qed A:1-251 [150676] complexed with edo, fe |
PDB Entry: 2qed (more details), 1.45 Å
SCOP Domain Sequences for d2qeda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} mnlnsipafqdnyiwvltndegrcvivdpgeaapvlkaiaehkwmpeaiflthhhhdhvg gvkellqhfpqmtvygpaetqdkgathlvgdgdtirvlgekftlfatpghtlghvcyfsr pylfcgdtlfsggcgrlfegtpsqmyqslmkinslpddtliccaheytlanikfalsilp hdsfineyyrkvkelrvkkqmtlpvilknerkinlflrtedidlineinketilqqpear fawlrskkdtf
Timeline for d2qeda1: