Lineage for d2qdyb_ (2qdy B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393361Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2393417Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
    contains irregular array of helices in the N-terminal extension
    automatically mapped to Pfam PF02211
  6. 2393427Protein Iron-containing nitrile hydratase [50102] (1 species)
  7. 2393428Species Rhodococcus erythropolis [TaxId:1833] [50103] (28 PDB entries)
    also Rhodococcus sp. R312
  8. 2393447Domain d2qdyb_: 2qdy B: [150675]
    Other proteins in same PDB: d2qdya_
    automated match to d1ahjb_
    complexed with cl, fe, gol, ibn, mg

Details for d2qdyb_

PDB Entry: 2qdy (more details), 1.3 Å

PDB Description: crystal structure of fe-type nhase from rhodococcus erythropolis aj270
PDB Compounds: (B:) Nitrile hydratase subunit beta

SCOPe Domain Sequences for d2qdyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qdyb_ b.34.4.4 (B:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepa

SCOPe Domain Coordinates for d2qdyb_:

Click to download the PDB-style file with coordinates for d2qdyb_.
(The format of our PDB-style files is described here.)

Timeline for d2qdyb_: